CEACAM6 Rabbit Polyclonal Antibody TA346090 from OriGene Technologies | Biocompare.com

Supplier Images

CEACAM6 Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
CEACAM6 Rabbit Polyclonal Antibody

The CEACAM6 Rabbit Polyclonal Antibody from OriGene Technologies is a Rabbit Polyclonal antibody to CEA cell adhesion molecule 6. This antibody recognizes Human antigen. The CEACAM6 Rabbit Polyclonal Antibody has been validated for the following applications: Immunohistochemistry, and Western Blot.

Description

Rabbit Polyclonal Anti-CEACAM6 Antibody

Product Specs
ItemCEACAM6 Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA346090
Quantity100 µl
ApplicationsIHC, WB
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetCEACAM6
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-CEACAM6 antibody: synthetic peptide directed towards the middle region of human CEACAM6. Synthetic peptide located within the following region: EIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNP
NCBI Full Gene NameCEA cell adhesion molecule 6
NCBI Gene AliasesCD66c, CEAL, NCA
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!